SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290580047|ref|YP_003484439.1| from Streptococcus mutans NN2025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290580047|ref|YP_003484439.1|
Domain Number 1 Region: 66-333
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.44e-68
Family L-arabinose binding protein-like 0.000000398
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.61e-19
Family GalR/LacI-like bacterial regulator 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290580047|ref|YP_003484439.1|
Sequence length 333
Comment catabolite control protein A [Streptococcus mutans NN2025]
Sequence
MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLA
SKKTTTVGVVIPNIANAYFSILAKGIDDIATMYKYNIVLASSDEDDDKEVNVINTLFAKQ
VDGIIFMGHHLTEKIRAEFSRARTPVVLSGTVDLEHQLPSVNIDHSKAAQDAVALLAKHH
DKIAFVSGPFIDDINGKVRLAGYKEGLKKKGLPFKEGLVFEAQYKYQEGYQLAQRVINSG
ATAAYVAEDELAAGLLNGLFAAGKKVPEDFEIITSNDSTIALYTRPNMTSISQPIYDLGA
VAMRMLTKIMNKEELEEKEIVLNHGIRERGTTK
Download sequence
Identical sequences A0A0E2EZ79
WP_002264971.1.15704 WP_002264971.1.16444 WP_002264971.1.1718 WP_002264971.1.18958 WP_002264971.1.2040 WP_002264971.1.27968 WP_002264971.1.28176 WP_002264971.1.29492 WP_002264971.1.30735 WP_002264971.1.30759 WP_002264971.1.30947 WP_002264971.1.32790 WP_002264971.1.36939 WP_002264971.1.37774 WP_002264971.1.398 WP_002264971.1.41490 WP_002264971.1.41875 WP_002264971.1.43025 WP_002264971.1.43640 WP_002264971.1.43675 WP_002264971.1.45183 WP_002264971.1.45508 WP_002264971.1.46710 WP_002264971.1.46727 WP_002264971.1.49188 WP_002264971.1.50052 WP_002264971.1.51230 WP_002264971.1.51387 WP_002264971.1.51717 WP_002264971.1.51880 WP_002264971.1.54052 WP_002264971.1.54626 WP_002264971.1.5956 WP_002264971.1.60757 WP_002264971.1.60865 WP_002264971.1.61642 WP_002264971.1.62848 WP_002264971.1.65660 WP_002264971.1.66026 WP_002264971.1.67232 WP_002264971.1.6903 WP_002264971.1.69244 WP_002264971.1.70378 WP_002264971.1.73818 WP_002264971.1.73964 WP_002264971.1.77182 WP_002264971.1.80341 WP_002264971.1.81687 WP_002264971.1.83363 WP_002264971.1.88284 WP_002264971.1.90023 WP_002264971.1.90204 WP_002264971.1.91353 WP_002264971.1.91503 WP_002264971.1.93269 WP_002264971.1.93729 WP_002264971.1.95949 WP_002264971.1.96000 WP_002264971.1.98526 WP_002264971.1.98911 gi|290580047|ref|YP_003484439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]