SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290580183|ref|YP_003484575.1| from Streptococcus mutans NN2025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290580183|ref|YP_003484575.1|
Domain Number 1 Region: 38-259
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.54e-20
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290580183|ref|YP_003484575.1|
Sequence length 333
Comment hypothetical protein SmuNN2025_0657 [Streptococcus mutans NN2025]
Sequence
MKNKRLLGVLLALAVLVIGILVYQSVDKQNRKNSQSGTFKVGVLQYVSHNALDEIYRGIK
AGLKEEGYSGKKIKIDFMNAEGDQSKVQTMSQTLVNHKNDVLVGIATPAAQGLASATKET
PIIMGAVTDPVGAKLIKDLKKPNGNVTGVSDKTPISDQVSLIKKLTPDVKTVGILYSSSE
DNSKSQVEEFKKIAEKKGYKVLEYSVPSTNEIATTMNVMLDKTDAVWIPLDNTIASAFPT
VVSAAKTAKKPIYPSVDTMVTEGGLASVVVDQYKLGVATGKMAVKVFEGKKVSQLPVDIF
DKGTPVVNKKVAKELGIDIPSDILKKAKQQKNQ
Download sequence
Identical sequences gi|290580183|ref|YP_003484575.1| gi|387785846|ref|YP_006250942.1| WP_002266200.1.101419 WP_002266200.1.11334 WP_002266200.1.11591 WP_002266200.1.12932 WP_002266200.1.17336 WP_002266200.1.18742 WP_002266200.1.18958 WP_002266200.1.27968 WP_002266200.1.28176 WP_002266200.1.29492 WP_002266200.1.30473 WP_002266200.1.30759 WP_002266200.1.32790 WP_002266200.1.36850 WP_002266200.1.37641 WP_002266200.1.4093 WP_002266200.1.45235 WP_002266200.1.50471 WP_002266200.1.51230 WP_002266200.1.51366 WP_002266200.1.55052 WP_002266200.1.5956 WP_002266200.1.59872 WP_002266200.1.60757 WP_002266200.1.62848 WP_002266200.1.65140 WP_002266200.1.66026 WP_002266200.1.69244 WP_002266200.1.74195 WP_002266200.1.7770 WP_002266200.1.80341 WP_002266200.1.81687 WP_002266200.1.86849 WP_002266200.1.87803 WP_002266200.1.88284 WP_002266200.1.89520 WP_002266200.1.91353 WP_002266200.1.91503 WP_002266200.1.95315 WP_002266200.1.956 WP_002266200.1.96000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]