SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290580446|ref|YP_003484838.1| from Streptococcus mutans NN2025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290580446|ref|YP_003484838.1|
Domain Number 1 Region: 49-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.77e-17
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290580446|ref|YP_003484838.1|
Sequence length 349
Comment ABC transporter [Streptococcus mutans NN2025]
Sequence
MNKKIIGLGLTAVAVLGLAACGNRAAREKGKAKTDLKVAIVTDTGGVDDKSFNQSAWEGL
QAWGKENGLSKGNGFDYFQSASESDYATNLDTASSSGYKLIFGIGYALHDAIEKTAADNK
NIHYVIIDDVIQKKNNVASVTFADNEAAYLAGIAAAKTTKSKKVGFVGGVKSEVITRFEK
GFEAGVKSVDSSIQIQVDYAGSFGDAAKGKTIAAAQYASGADVIYQAAGGTGAGVFSEAK
AVNEKKKENKKVWVIGVDRDQAAEGKYTSKDGKKSNFVLASSLKEVGKAVQLISTNTSKK
KFPGGKVTTYGLKDKGVDLVPTHLSKEGKKAVDDAKKKIVSGDVKVPEK
Download sequence
Identical sequences WP_002265487.1.11334 WP_002265487.1.16444 WP_002265487.1.27968 WP_002265487.1.28176 WP_002265487.1.30473 WP_002265487.1.32163 WP_002265487.1.32790 WP_002265487.1.4093 WP_002265487.1.43025 WP_002265487.1.50471 WP_002265487.1.5956 WP_002265487.1.60757 WP_002265487.1.62848 WP_002265487.1.67144 WP_002265487.1.69244 WP_002265487.1.7464 WP_002265487.1.80579 WP_002265487.1.81687 WP_002265487.1.83426 WP_002265487.1.88284 WP_002265487.1.91353 WP_002265487.1.91503 WP_002265487.1.94501 WP_002265487.1.96000 gi|387786099|ref|YP_006251195.1| gi|290580446|ref|YP_003484838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]