SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282162790|ref|YP_003355175.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282162790|ref|YP_003355175.1|
Domain Number 1 Region: 15-464
Classification Level Classification E-value
Superfamily L-aspartase-like 5.81e-118
Family L-aspartase/fumarase 0.000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282162790|ref|YP_003355175.1|
Sequence length 495
Comment argininosuccinate lyase [Methanocella paludicola SANAE]
Sequence
MENKEDILRRGRLSAAKSEEINAFTSSLQADRWIFPSDIMVDKAHTAMLARQGVIDKKDA
AAILKALDSIGAGGVDAVDIPAFEDVHMAIESKLIKSVGENVGGRMHSGRSRNDEVITCV
RISARKELLGLMADLLELRKAIVGLASNNMDTVMPGFTHLQHAQPTTLAHHLMAHASALD
RDFERLLDAYKFININPLGSAAFASTGYPLDREYTTKLLGFDRPMDNSMDGVSSRDFILT
TISAIAILETDLSRLADELVLWSTPEFGFVELDDAYASTSSIMPQKKNPDILELVRGRAG
TVIGHMVAAFTIVKALPYSYNSDLQEVTPQLLRSFEISRSSVRIMTGAVSTLKINNEEMA
RKSTMGFTTATEIADTIVRATGLPFRTAHGIVGRLARGDGNPSLADVDRASMDMIGKKLS
RMGLTEKALEEAKDPLKNVRRRSILGGPAKAAVTSKIAAEKERLKADAKAASGLAKKLAK
AEGGLAKAVSDIIKG
Download sequence
Identical sequences D1YUS0
304371.MCP_0120 gi|282162790|ref|YP_003355175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]