SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282162988|ref|YP_003355373.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282162988|ref|YP_003355373.1|
Domain Number 1 Region: 44-82
Classification Level Classification E-value
Superfamily gp5 N-terminal domain-like 0.000000497
Family gp4 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282162988|ref|YP_003355373.1|
Sequence length 286
Comment hypothetical protein MCP_0318 [Methanocella paludicola SANAE]
Sequence
MVTMPRYFIDIGQVTKVMPHKSNNDGANYHCDIMLRDSGNSLTNVPVASTRMGFACIPEV
DDHVLVGFIRGNLYMPVILGTLYNDQAKPPLYLEGEAVYVCPEYKQKQSSDPKPEELKRI
YMELPKHKMKLIVREEDVHYELLKYKFDLKKEEGIKLEVNEKTSLAISKDGDITITAKDT
KISINKEGEIAIDSKQKVGIKTTAEVSLESSGGDMKLTANNITLKGNQSVSIEGTQAVEI
KGTNAKMEAKAQLDIKGAMAKVEATGMMDVKASGVMNIKGSIVNIN
Download sequence
Identical sequences D1YVB8
gi|282162988|ref|YP_003355373.1| 304371.MCP_0318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]