SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282162999|ref|YP_003355384.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282162999|ref|YP_003355384.1|
Domain Number 1 Region: 121-251
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.09e-28
Family MJ1460-like 0.025
Further Details:      
 
Domain Number 2 Region: 21-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.89e-16
Family MarR-like transcriptional regulators 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|282162999|ref|YP_003355384.1|
Sequence length 251
Comment putative transcriptional regulator [Methanocella paludicola SANAE]
Sequence
MKQKKGRDERAAELFATEGGIRAVDSPVRMSILSMLLEKEMRFDEIVEASGRAKSTISVH
LKSLADDGIVSSRADPADARKKIFFIDSSYLGGLSRRKKLKKDMTEYISKYAMSSGDPFA
FFRLMFRTIRVALLDEGIDLDPVLHEAGASVGEALYPRVADPDLGRLLANLAKFWEAQKL
GRLDVRSVEPLDIVICDCFECQDLPYLGRPACAFDSGIFETIFTKYYNSPAKVKETKCYA
MGDGRCEFIIE
Download sequence
Identical sequences D1YVC9
gi|282162999|ref|YP_003355384.1| 304371.MCP_0329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]