SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282163322|ref|YP_003355707.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282163322|ref|YP_003355707.1|
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 1.16e-55
Family NIF3 (NGG1p interacting factor 3)-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|282163322|ref|YP_003355707.1|
Sequence length 251
Comment hypothetical protein MCP_0652 [Methanocella paludicola SANAE]
Sequence
MKLSDLVSRLEEIAPPALAEEFDAGRIGLIVKGAEDVDMVATALDPTPYVIRRAVEEGAQ
ALVTHHTLIWDPVNVINEDLAVRLKLLLDSGMSLYSMHTNYDNAPGGVNDALAELLGLSD
TVVFYGGRAGNVPEMSLGRFASLASERLGCDVEYVGDDERSVRRAVVVSGSGFRLALDEA
RKADVDVLLSSELKHDVILGRGDVALVSAPHYFTEAPAMKALAERLSRTVPAVFIDDPPG
IKTIQKDGKRS
Download sequence
Identical sequences D1YWA2
gi|282163322|ref|YP_003355707.1| 304371.MCP_0652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]