SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282164689|ref|YP_003357074.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282164689|ref|YP_003357074.1|
Domain Number 1 Region: 163-353
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.94e-66
Family Actin/HSP70 0.000000821
Further Details:      
 
Domain Number 2 Region: 355-511
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 3.01e-61
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000203
Further Details:      
 
Domain Number 3 Region: 1-159
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.29e-56
Family Actin/HSP70 0.00000621
Further Details:      
 
Domain Number 4 Region: 478-577
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000000000000824
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282164689|ref|YP_003357074.1|
Sequence length 617
Comment heat shock protein 70 [Methanocella paludicola SANAE]
Sequence
MSKIIGIDLGTSNSEAAVLEGGKPTIIPSAEGARLFPSYVAFTKTGERLVGEAARRQAVT
NPERTVLAIKRKMGTDHKVDIDGKKYTPQEISAMILSKIKQDAEAFLGEKISKAVITVPA
YFNDNQRQATKDAGTIAGLEVLRVINEPTAAALAYGLDKTGTQKILVFDLGGGTLDVTIM
EMGEGVFEVLSTSGDTQLGGTDMDNRIIDYIANSFQKENGIDLRKDKMAMQRLRDAAEKA
KIELSSTLQTNVNLPFITADQNGPKHLDMTLTRAKLEELVREVVDRCYAPMRQAISDAKL
TATNIDHIILVGGPTRMPMVQEMVRKFFGKEPERGIDPMECVAMGAAIQGGVLAGEVKDL
LLLDVTPLSLGIETFGAVFTKLIERNTTIPTRKSQVFSTAADNQTSVEIHVLQGERPMAS
DNTTLGRFHLIGIPPAPRGIPQIEVTFDIDANGIMNVKAKDLGTGKEQAITITASTKLSK
DQIDRMMKDAEKFASEDAKKKEKAEVTNNADSILYAAQKTVAEAGDKITADQKDKINKGI
EALKEAQKTDDMNKIKAETENLTKVVNEAATVMYQQAAQAYQQQQQAKQQQQAQPNGGGK
DPNVVDAEFEVKDEKKN
Download sequence
Identical sequences D1Z069
304371.MCP_2019 gi|282164689|ref|YP_003357074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]