SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282165098|ref|YP_003357483.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282165098|ref|YP_003357483.1|
Domain Number 1 Region: 4-438
Classification Level Classification E-value
Superfamily L-aspartase-like 6.75e-130
Family L-aspartase/fumarase 0.0000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282165098|ref|YP_003357483.1|
Sequence length 445
Comment adenylosuccinate lyase [Methanocella paludicola SANAE]
Sequence
MAIHPIEFRYGTPEMKAVWTEESKLLKLLMVEAALAKAEAEVGLVSRSDAETIASCMNKV
NVERVRQIEDEISHDMMAVVLAYAEQCGEAGKWIHYGATSNDILDTGLALQLKDAMEIID
DKLEKLKQALLKKADETKTLVTAGRTHGQLAVPTTYGLRFAIWAMEVARHQERLRQMKPR
VAVGQMSGAVGTQAAFGKDGIRIKELTMRELGIPAVTVSSQIIQRDRHAEYMEFLALVAS
TLDKICLEIRLMQRSEIGELAEGFGKKQVGSSTMPHKRNPINSEQVCGLARVVRAYVEPA
LENNALWDERDLTNSSCERVIIPEASILLDHILRKTINVISGLTFYPENIKRNLNVLKGV
QMSEAVMIALANRGFGRQKAHEIVRSASMKAFEHNMPFRQALMEDTEISGKLTPAEIDEI
TDPAKYIGTAMEQVEEVLRKEGYVH
Download sequence
Identical sequences D1Z1C8
304371.MCP_2428 gi|282165098|ref|YP_003357483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]