SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282165423|ref|YP_003357808.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282165423|ref|YP_003357808.1|
Domain Number 1 Region: 116-242
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.3e-29
Family MJ1460-like 0.021
Further Details:      
 
Domain Number 2 Region: 19-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000509
Family Hypothetical protein PH1932 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282165423|ref|YP_003357808.1|
Sequence length 244
Comment putative transcriptional regulator [Methanocella paludicola SANAE]
Sequence
MRDQVEIYSTKKGMIAIESPIKNRILQKLAERELTFEELIEVCGKARSTMSVHLNDLLSM
GLVYKRVDSRDRRKKYFGLNTDLLASSKMPVTTHYDKILQSVPATIGDQYGFLKSLFHLV
RSGMESYGVDTSPALKKIGRDVGRVLAPRFKATTADALLKEVSQFWESQGLGRVSIVKGD
VPTIIVDDCFDCSTMPNIGQTQCSMDEGILEAIIEEKLKVRCSIEEVECYGTGHHHCKFL
IKIF
Download sequence
Identical sequences D1Z2A3
gi|282165423|ref|YP_003357808.1| 304371.MCP_2753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]