SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282163990|ref|YP_003356375.1| from Methanocella paludicola SANAE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282163990|ref|YP_003356375.1|
Domain Number 1 Region: 203-337
Classification Level Classification E-value
Superfamily CBS-domain pair 4.8e-32
Family CBS-domain pair 0.003
Further Details:      
 
Domain Number 2 Region: 346-432
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.54e-24
Family CorC/HlyC domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282163990|ref|YP_003356375.1|
Sequence length 437
Comment hypothetical protein MCP_1320 [Methanocella paludicola SANAE]
Sequence
MSNIWIEILIILLLILFNGLFAMAEIAIISGRKARLQQYAEEGDASAKSALELANSPGDF
LSTIQVGITLVGILAGAFGGATIAKEITPYIASYPALAPYSDVISILIVVLPITYLTIVI
GELVPKRIGLNYAERIARLIASPMRLLSKLAMPVVRLLSLSTDLILWALSVKPSTEPPVT
EEEIKVLIDQGAKAGVFEEAESDMVDSIFRLSDRRVSSMMVPRTDLTVLYLDDTVNDIVK
KIAESGHSSYPVCDSELDNVLGIVYVKDLLARYLEQNKLDLKATMKEPLFMPESMPALKA
LELFKKSGKHMAVIIDEYGGLQGLVTIHDIMESVVGDVPTIDSPRATQRDDGSWLVDGMM
PVDEFKNILDIKSLPDEDTGTFQTLGGFVMAHLHRIPAAGNKFTMEGYTYEVVDMDGMRV
DKVLVTPPKAEELNEKD
Download sequence
Identical sequences D1YY70
gi|282163990|ref|YP_003356375.1| 304371.MCP_1320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]