SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294055205|ref|YP_003548863.1| from Coraliomargarita akajimensis DSM 45221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294055205|ref|YP_003548863.1|
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.44e-31
Family Ribosomal protein L6 0.0001
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.66e-22
Family Ribosomal protein L6 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294055205|ref|YP_003548863.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Coraliomargarita akajimensis DSM 45221]
Sequence
MSRIGKLPVPVLDKAKVAVNGQTVSAEGPKGKLEKTFDSAVKIELVDNEVRVSPANSSRH
ARAMYGTARSIINNMVTGVVNGYSKQLELKGVGFRCALKGDVLDLALGYSHPCLLNIPQG
ITITVKDNTKITVEGADKEVVGEVTAKIFRFYPAEPYKGKGVHIVGQYVRRKEGKKSA
Download sequence
Identical sequences D5EJU4
gi|294055205|ref|YP_003548863.1| WP_013043415.1.49664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]