SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|260061914|ref|YP_003194994.1| from Robiginitalea biformata HTCC2501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260061914|ref|YP_003194994.1|
Domain Number 1 Region: 86-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-26
Family Translational machinery components 0.00026
Further Details:      
 
Domain Number 2 Region: 17-83
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.91e-22
Family Ribosomal S5 protein, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260061914|ref|YP_003194994.1|
Sequence length 174
Comment 30S ribosomal protein S5 [Robiginitalea biformata HTCC2501]
Sequence
MYGKYKNVETVKPGGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGHGLGKS
KEVATAIAKAVEDAKKNLIRIPLNKGTLPHEQKGKYGGARVYIQPASHGTGVIAGGAVRA
VLEAVGVQDVLSKSQGSSNPHNVVKATFDALLQLRDANTVAKQRGISLEKVFNG
Download sequence
Identical sequences A4CJV8
WP_015753969.1.95753 313596.RB2501_09940 gi|260061914|ref|YP_003194994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]