SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260063766|ref|YP_003196846.1| from Robiginitalea biformata HTCC2501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260063766|ref|YP_003196846.1|
Domain Number 1 Region: 123-274
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.94e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 395-557
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.06e-26
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0018
Further Details:      
 
Domain Number 3 Region: 19-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 
Domain Number 4 Region: 254-277,305-407
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.87e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260063766|ref|YP_003196846.1|
Sequence length 697
Comment sulfite reductase [Robiginitalea biformata HTCC2501]
Sequence
MKSFRTELENPVVEKDIVELERKIRQFREGELNEEKFRSLRLARGVYGQRQPGVQMVRIK
LPYGKVTARQLHRIADVSDTYSTGILHITTRQDIQIHYVDLDRTPELWAELERDAVTLRE
ACGNTVRNVTASETAGIDPGEPFDVSPYAQALFEYFLRNPVGQEMGRKFKVSFSASDADT
GLSYMHDLGFIARVEAGRRGFKVLVGGGLGAQPRHADVLYEFLPQEQIIPLMERVLRVFD
RYGERKSRAKARMKFLIRDIGLDRFRELLAEETPGIPVREYPIDAEAYPQPRPASTPPDI
PVPADMEAYQAWKRTNTIRQKQDGYVAVGLRVFLGNFTTRQARQLADLVARYAASEIRLS
LRQNILIPFVREAWLPYFHNELEKIGLAQPGYNTAADITACPGTDTCNLGIASSTGIATE
LERVIAAEYPDFIHNPDVVIKISGCMNACGQHNMAHIGFQGMSVRTRDKRVAPALQVLLG
GGNRGGGEGIFADKVIKIPSKRGPQALRIILDDYLENGGGQPYDRYYQEQGQHYFYDKLK
PLSDVSDLTPEDFIDWGTDKKYEKAIGIGECAGVVIDLISTLLLEAEEKLEDAQKALEAG
KWAASIYYAYSAQIHAAKALLTSEDVAVNSHAAILKDFDTHFIDQPRGFGNDSFRQAVLR
MNRHAPDAGFAREYLEQARNFLSEASAFRQKELSHAS
Download sequence
Identical sequences A4CPR3
313596.RB2501_03130 WP_015755820.1.95753 gi|260063766|ref|YP_003196846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]