SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386085988|ref|YP_006001862.1| from Streptococcus thermophilus ND03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386085988|ref|YP_006001862.1|
Domain Number 1 Region: 36-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.4e-71
Family Phosphate binding protein-like 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386085988|ref|YP_006001862.1|
Sequence length 300
Comment metal ion ABC transporter substrate-binding protein/surface antigen [Streptococcus thermophilus ND03]
Sequence
MKFKKILVITVLAVASTVALAACGAGGNKSAKDDKTLTVGIMTLDNTTEPVWDKVKELAK
DKGVTIDLKEFTDFNQPNKALKNGEIDVNAFQHIYFLNNWNKENKGDLVPVADTLLSPIH
LFSGTENGKAKYKDVKELPEGATISVPNDSTNESRALTLLQTAGLLKLDVKDGELATIKN
ISENPKKLEIKEISAEQAAQTLSSVDAAVVNNTYAQQQNVDYNTTLFQEDPSQDLKEWVN
IIAANKDWEKSNKSDAIKTLIKAYQNDEVAQIIYDASNKVDLPAWKGAPTRDQLEANSKK
Download sequence
Identical sequences WP_014607957.1.20570 WP_014607957.1.49400 WP_014607957.1.60701 WP_014607957.1.71797 WP_014607957.1.84427 gi|386085988|ref|YP_006001862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]