SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289577922|ref|YP_003476549.1| from Thermoanaerobacter italicus Ab9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289577922|ref|YP_003476549.1|
Domain Number 1 Region: 8-132
Classification Level Classification E-value
Superfamily AF1862-like 1.96e-36
Family Cas Cmr5-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289577922|ref|YP_003476549.1|
Sequence length 135
Comment CRISPR-associated protein, Cmr5 family [Thermoanaerobacter italicus Ab9]
Sequence
MTDKDSIKTTVNERAKFAYECVKKVATYEKEEFKNNYKSYAKKLMAIIKTNGLGATLAFM
KAKGSSAYQELYNNIDSWLKSENCPVSSLYSNSTADMVEKIISLESDAYRAITKEVMEFI
NWIRRFAEGMIPDDK
Download sequence
Identical sequences D3T7Q5
gi|289577922|ref|YP_003476549.1| WP_012994795.1.100455 WP_012994795.1.28907 WP_012994795.1.7020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]