SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289578249|ref|YP_003476876.1| from Thermoanaerobacter italicus Ab9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289578249|ref|YP_003476876.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.96e-31
Family YheA-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289578249|ref|YP_003476876.1|
Sequence length 109
Comment hypothetical protein Thit_1047 [Thermoanaerobacter italicus Ab9]
Sequence
MNVYDKAYELANAIKQLPEYKALKEAYRKINENEQNKKMLEDFKKKQLEIQAKELSGEKV
EPKEKEVLEKLWEILNLNPDISSYLSLEYTFSKMMNDILKIITEPMEMN
Download sequence
Identical sequences D3T8N2 D7ANQ4
gi|297544529|ref|YP_003676831.1| gi|289578249|ref|YP_003476876.1| WP_012995113.1.100455 WP_012995113.1.28907 WP_012995113.1.7020 WP_012995113.1.86608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]