SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289578638|ref|YP_003477265.1| from Thermoanaerobacter italicus Ab9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289578638|ref|YP_003477265.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily YjgF-like 5.65e-49
Family YjgF/L-PSP 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289578638|ref|YP_003477265.1|
Sequence length 125
Comment endoribonuclease L-PSP [Thermoanaerobacter italicus Ab9]
Sequence
MKTIINTDAAPKAIGPYSQAIMIDGFLYTSGQIAIDPATGELVEGGIEAQTERVLENIKA
ILKAAGMDFNNVIKTTVFVTNIRDFAKINEIYGKYFKDNPPVRSLVEVKSLPKGALIEIE
VVAHR
Download sequence
Identical sequences D3T3A1
WP_012995439.1.100455 gi|289578638|ref|YP_003477265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]