SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295703027|ref|YP_003596102.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295703027|ref|YP_003596102.1|
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily SIS domain 8.23e-38
Family mono-SIS domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295703027|ref|YP_003596102.1|
Sequence length 185
Comment 6-phospho 3-hexuloisomerase [Bacillus megaterium DSM 319]
Sequence
MQTSEHLKTVMNELLQTTALIADDEAEQLVNGIISSKKVFVTGAGRSGLMGKSFAMRMMH
MGIDAYVIGETVTSTFTQDDLLIIGSGSGETKSLIPIAQKAKELGGKVGVVTISSDSTLG
KLADFIVKLPGAPKDQEQSSYQTVQPMASLFEQTLLLFYDALILRFMEKKELDTHTMYGK
HANLE
Download sequence
Identical sequences D5DCD2
WP_013081915.1.11259 gi|295703027|ref|YP_003596102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]