SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295703293|ref|YP_003596368.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295703293|ref|YP_003596368.1|
Domain Number 1 Region: 6-171
Classification Level Classification E-value
Superfamily SIS domain 3.64e-23
Family mono-SIS domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295703293|ref|YP_003596368.1|
Sequence length 241
Comment hypothetical protein BMD_1157 [Bacillus megaterium DSM 319]
Sequence
MSSLYLQELTKLLAKVEAHEQQAMESAAEKISQQLASHHLIHLFGCGHSHILTEEVFYRS
GGLAPIHPIFVEELMLHKGASRSSQLERKNDYASTFMEKEDIVPGDIMIVISTSGVNPVP
IDVALIAKEKGAFVIGLTSPSYATSRASRHKSGKYLHDVVDLVINNHIPKGDVLLHQQDI
SFASGSTVIGGAILNDVLSKAIQKLLSRGITPPVFLSGNMEGSDEHNQRLIDAYKGRITA
L
Download sequence
Identical sequences A0A0B6ASB4 A0A1I2SSG4 D5DCR9
WP_013082151.1.11259 WP_013082151.1.30509 WP_013082151.1.44691 WP_013082151.1.61351 WP_013082151.1.91935 WP_013082151.1.94149 gi|295703293|ref|YP_003596368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]