SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295704491|ref|YP_003597566.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295704491|ref|YP_003597566.1|
Domain Number 1 Region: 11-328
Classification Level Classification E-value
Superfamily SIS domain 1.95e-60
Family double-SIS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295704491|ref|YP_003597566.1|
Sequence length 328
Comment fructoselysine-6-P-deglycase [Bacillus megaterium DSM 319]
Sequence
MSRTAVNVKSDVQAVLNELKSKQIRNVFFVACGGSSAIMYPAKYVLDREAQHITSDLYSS
NEFIHRNPQQLGKDSLVILCSMSGTTPETTEAAKFAKSKGAYAVALTNEPTSPLAHSADI
FIKYEWGNDIDAFETNLGVLYQLVFGLLYVAEKNDKFAKLVTSLENLQSVYEKALEYEAS
NARKFAESHKSEPVIYTMASGSNYGAAYSFSICILMEMQWIHSHAIHAGEYFHGPFEIID
ENVPFIILAGLDETRPLEERALSFSKRYGKKLTVLDAKAYDFEGIDKDVQGYIAPLVLNR
VLRQYAEELAEARNHPLSKRRYMWKVEY
Download sequence
Identical sequences A0A1I2ZER6 D5DFT9
WP_013083209.1.11259 WP_013083209.1.30509 WP_013083209.1.71276 WP_013083209.1.77638 gi|295704491|ref|YP_003597566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]