SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295705805|ref|YP_003598880.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295705805|ref|YP_003598880.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily SIS domain 3.34e-73
Family mono-SIS domain 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|295705805|ref|YP_003598880.1|
Sequence length 296
Comment N-acetylmuramic acid 6-phosphate etherase [Bacillus megaterium DSM 319]
Sequence
MLEHLTTETRNEKTMNLDEMSIFDFLTTMNEEDEKVASAIKKELPSIAKAVEAIIEAKKQ
GGRLIYIGAGTSGRIGLLDAVECPPTFGTSPDEVIGLIAGGEKAFIKAVEGAEDSKELGM
EDLQNIRLTKADIVVGIAASGRTPYVIGALEYANSIEAQTVAVSCNKGSDIGKVANIAIE
VINGPEVLTGSTRLKAGTAQKLVCNMLSTASMVGIGKVYGNLMVDVQLTNEKLVERAKRI
VMEATSCTYDTAEEYLAKANCNSKLAIVMILTGLSYEESLHRLEQTQGFIRQAIVN
Download sequence
Identical sequences A0A0B6AT30 D5DIW1
WP_013084385.1.11259 WP_013084385.1.44691 WP_013084385.1.61351 WP_013084385.1.71276 WP_013084385.1.91935 WP_013084385.1.94149 gi|295705805|ref|YP_003598880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]