SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295706998|ref|YP_003600073.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295706998|ref|YP_003600073.1|
Domain Number 1 Region: 5-447
Classification Level Classification E-value
Superfamily SIS domain 6.81e-147
Family Phosphoglucose isomerase, PGI 0.0000000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295706998|ref|YP_003600073.1|
Sequence length 449
Comment glucose-6-phosphate isomerase [Bacillus megaterium DSM 319]
Sequence
MTHVRFDYSNALSFFGEHELTYLRDAVKVAHHSIHEKTGAGNDFLGWVDLPTEYDKEEFA
RIQKSAEKIKSDSDVLIVIGIGGSYLGARAAIEMLQHSFYNTLSKEQRKTPQVIFAGNNI
SSTYMKDLMDVLQDKDFSINVISKSGTTTEPAIAFRIFRKLLEEKYGKEEARKRIYATTD
KARGALKTLADEEGYETFVIPDDVGGRYSVLTAVGLLPIAAAGLDIEQMMKGAADAQEAF
SSSELEENPAYQYAVARNVLYNKGKTIEMLINYEPALQYFAEWWKQLFGESEGKDQKGIY
PSSANFSTDLHSLGQYVQEGRRDIFETIVQVQDSRHELTIEEDAADLDGLNYLAGETVDF
VNKKAFQGTMLAHTDGGVPNLVVNIPALDEYTFGYVVYFFEKACAISGYLLGVNPFDQPG
VEAYKVNMFALLGKPGFEEKKAELEKRLK
Download sequence
Identical sequences A0A0B6ARQ1 A0A0L1M774 A0A0M0WTB1 A0A0Q6HI24 A0A109GA83 A0A1G6YA32 D5DLW8 D5DUM7
gi|294501650|ref|YP_003565350.1| WP_013059589.1.100032 WP_013059589.1.11259 WP_013059589.1.12495 WP_013059589.1.18762 WP_013059589.1.22068 WP_013059589.1.30509 WP_013059589.1.44691 WP_013059589.1.53165 WP_013059589.1.54970 WP_013059589.1.56431 WP_013059589.1.61351 WP_013059589.1.62029 WP_013059589.1.64554 WP_013059589.1.65684 WP_013059589.1.71276 WP_013059589.1.73947 WP_013059589.1.76027 WP_013059589.1.77219 WP_013059589.1.77638 WP_013059589.1.80264 WP_013059589.1.91935 WP_013059589.1.92059 WP_013059589.1.9244 WP_013059589.1.94149 WP_013059589.1.96672 gi|295706998|ref|YP_003600073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]