SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295707237|ref|YP_003600312.1| from Bacillus megaterium DSM 319

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295707237|ref|YP_003600312.1|
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily SIS domain 0.0000834
Family mono-SIS domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295707237|ref|YP_003600312.1|
Sequence length 176
Comment hypothetical protein BMD_5163 [Bacillus megaterium DSM 319]
Sequence
MLKIFTTQLSGFFKRIEEQEEFQFEDAARILAQASVGEGFIYIYGVEEMHAITLEALSSA
EPLSQAKALPLHELDQLTSVDRVLLVSRFSTDNKAMEIAERLKKRDIPFVSIAAVPKEIA
EPSLTALADAHIDTKLLKPLIPGEDGSRFGYPAMIVALYAYYGLTFTLKEIVEEYE
Download sequence
Identical sequences D5DM78
WP_013085480.1.11259 gi|295707237|ref|YP_003600312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]