SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283457828|ref|YP_003362426.1| from Rothia mucilaginosa DY-18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283457828|ref|YP_003362426.1|
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily Formyltransferase 4.32e-46
Family Formyltransferase 0.0000109
Further Details:      
 
Domain Number 2 Region: 208-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.4e-22
Family Post formyltransferase domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283457828|ref|YP_003362426.1|
Sequence length 322
Comment methionyl-tRNA formyltransferase [Rothia mucilaginosa DY-18]
Sequence
MLNIIYAGTPDVAVPPLDYLANSDKVRVVGVLTREDAPVGRKRVLTPSPVAQRAEELGLP
IVKANRWNDAAAAAIAELNADAAAVVAYGALLPLPALESLRYGWVNLHFSKLPAWRGAAP
VQRALIAGEQEIFSTTFLLEEGLDTGPTFEQESTPVAADDTAGSVLMRLATSGGALLERT
FERLEAGESGTVQVEDESVSYASKMSIADGRLTWTEPAEQILARFRGVTPEPGAWCELGE
NRFKIGGLAVADERLVQSLTEANGGPLAPGAVRLHAKKVLVGTGTEPLMLLQVQPAGKKM
MDAPAWARGAGKDMAEGLVVLA
Download sequence
Identical sequences D2NSI0
WP_012903299.1.56984 gi|283457828|ref|YP_003362426.1| 680646.RMDY18_07740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]