SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283458679|ref|YP_003363314.1| from Rothia mucilaginosa DY-18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283458679|ref|YP_003363314.1|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Formyltransferase 5.36e-61
Family Formyltransferase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283458679|ref|YP_003363314.1|
Sequence length 198
Comment folate-dependent phosphoribosylglycinamide formyltransferase PurN [Rothia mucilaginosa DY-18]
Sequence
MRIVVMVSGSGTNLQSILDAVAAGELPLDIAAVGADKPCLGIERAQAAGVPTFLVQPGDY
ADRPSWNRALEEKIASYNPDYIVFAGFMRIVDAQLVERFKNRIINTHPALLPSFPGAHGV
RDALAHGVKITGLTVHFVDAGVDTGPILAQAAVPVLDDDTEETLHERIKVQERRLLVQTI
ASLAESHGAASDGAASDS
Download sequence
Identical sequences D2NPC6
gi|283458679|ref|YP_003363314.1| 680646.RMDY18_16620 WP_012904096.1.23324 WP_012904096.1.39259 WP_012904096.1.42107 WP_012904096.1.43391 WP_012904096.1.46547 WP_012904096.1.56984 WP_012904096.1.99508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]