SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283458976|ref|YP_003363625.1| from Rothia mucilaginosa DY-18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283458976|ref|YP_003363625.1|
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.06e-21
Family Ribosomal protein L9 C-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.14e-17
Family Ribosomal protein L9 N-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283458976|ref|YP_003363625.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Rothia mucilaginosa DY-18]
Sequence
MAKIILTQEVSGLGAAGDVVTVKDGYARNYLLPRGFAVTWTQGGEKQVESIRAARAARAK
ASLEEAQAIAASLAAKPVVVAHKAGADGRLFGTVKAEAIAEAIEAAGVGSVDKRTIHLGS
AIKRTGEYKVTVRLHADVVANVVLDVVAAA
Download sequence
Identical sequences A0A1E8TU29 A0A1F0VNJ9 A0A1S1D4Y8 A0A2I1Z7Q9 D2NQ87
gi|283458976|ref|YP_003363625.1| WP_012904373.1.31261 WP_012904373.1.56984 WP_012904373.1.59805 WP_012904373.1.97539 680646.RMDY18_19730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]