SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289191663|ref|YP_003457604.1| from Methanocaldococcus sp. FS406-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289191663|ref|YP_003457604.1|
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-41
Family GHMP Kinase, N-terminal domain 0.0000000496
Further Details:      
 
Domain Number 2 Region: 184-309
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 9.05e-28
Family Mevalonate kinase 0.00000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289191663|ref|YP_003457604.1|
Sequence length 312
Comment mevalonate kinase [Methanocaldococcus sp. FS406-22]
Sequence
MIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIREIDRNEIILNLNDLNKSLRLNLE
DIKNINPNNFGDFKYCLCAIKNTLNYINIEPKTGFEINISSKIPISCGLGSSASITIGTI
RAVSEFYDKELKDNEIAKLGYTVEKEIQGKASITDTSTITYRGILEIKNNKPKKIKGNFE
EFLKSCKFLIVYVEERKKKTAELVNEVAKIENKDEIFKEIDKIIDKALKVNSKEEFGKLM
TKNHELLKKLNISTPKIDRVVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELIKMLNK
ENVKIFKCKMIN
Download sequence
Identical sequences D3S758
gi|289191663|ref|YP_003457604.1| WP_012979780.1.35598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]