SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289192096|ref|YP_003458037.1| from Methanocaldococcus sp. FS406-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289192096|ref|YP_003458037.1|
Domain Number 1 Region: 6-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.42e-23
Family GHMP Kinase, N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 224-281
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000000196
Family Homoserine kinase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289192096|ref|YP_003458037.1|
Sequence length 282
Comment shikimate kinase [Methanocaldococcus sp. FS406-22]
Sequence
MEGRAYALASGTIINAIATGKGSAFGLNLKVYARVKLIDDGKNKIEGKVLDNPNIKPNLI
VRCVKNTLDYFGLNYSAYVETKTEIPIKSGLSSSSATSNAVVLATFDALGEKIDDELILN
LGIKSSFDEKLTVTGAYDDATASYYGGITITDNIKRKILKRDKMREDLNVLVLIPNLEKN
VDVNRMKLIKDYVEIAFNEAINGNYFKALFLNGILYASALNFPTKIAIDALEAGAITAGL
SGTGPSYIAIVEDENVEKVKEKLNRYGRVILTKPNNDGASIY
Download sequence
Identical sequences D3S8E1
WP_012980211.1.35598 gi|289192096|ref|YP_003458037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]