SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289192441|ref|YP_003458382.1| from Methanocaldococcus sp. FS406-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289192441|ref|YP_003458382.1|
Domain Number 1 Region: 694-807
Classification Level Classification E-value
Superfamily PKD domain 1.73e-22
Family PKD domain 0.0036
Further Details:      
 
Domain Number 2 Region: 803-888
Classification Level Classification E-value
Superfamily PKD domain 2.35e-21
Family PKD domain 0.00086
Further Details:      
 
Domain Number 3 Region: 891-974
Classification Level Classification E-value
Superfamily PKD domain 2.35e-19
Family PKD domain 0.0028
Further Details:      
 
Domain Number 4 Region: 409-503
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000034
Family PKD domain 0.0026
Further Details:      
 
Domain Number 5 Region: 189-249
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000157
Family PKD domain 0.0021
Further Details:      
 
Domain Number 6 Region: 523-595
Classification Level Classification E-value
Superfamily PKD domain 0.0000697
Family PKD domain 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|289192441|ref|YP_003458382.1|
Domain Number - Region: 49-108
Classification Level Classification E-value
Superfamily PKD domain 0.00432
Family PKD domain 0.0065
Further Details:      
 
Domain Number - Region: 301-360
Classification Level Classification E-value
Superfamily PKD domain 0.0471
Family PKD domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289192441|ref|YP_003458382.1|
Sequence length 1006
Comment PKD domain containing protein [Methanocaldococcus sp. FS406-22]
Sequence
MKILKLLMPVIILIAISMVNGYIIVIHPNTMNITNSSGVYNTNSSIIAYNVNDTLTFEAL
APNSVAQDILNNGVVKWDFGDLSETNYGSNKIVTHKYTFPFPYPVAWCGYLNNTGYSKAL
TYNWLVVGDVANTKYIFNGSPSNSKTSWDVYYNASNNTVVIKYYSETTVNTEFNGLSVDT
TPVIVNVSRDDIVEGDTVKFNFSVSRNIIFCVWSFGDGTFSFERSPEHTYSEAGFYYPRV
LVIDDSGRVMVGYLDEGIKVNRPRGGYIYWVTGPSHYNGEAYTYVYNSSGDDNDNRGNAY
TNPYKITYKVNDTIKFEMSGAWGLYWKWDFGDGTETAYTFKSYFTPSYHQYKFPFMWPFF
WMSYGAGSWWKSDTLNFIVVGDVGNTRYNFYPSPTHDKTSYDYEYNRENHTVNLYYYSDV
ISTPKLNVKLKDGYYIDITATADKTEVNVNENVKFDCSPYGNPIFIMWCFGDGTCSFEKS
PTHRYSSRGLYYPHVLIVDENGNIEVGIPPPIGVGGYSSYPQIYASPTIAPTNYPINITI
VEPVSWTYLWHHIYFGDGSSTWIKPKRSPYTFNHIYTSEGVYQIYMSVSTAQNMKIVYII
DNRNPIAKLYVYPNPASYKDTIVFNPINSYDPDAGRAIPEYNYYGKVIGYYNIPSTSPMA
KIYGFNLTVYDSSGNIVWNYSSNELTTISKSFPIGNYTAKLVVWDGMGGINSTTVKFSVI
NRPPVAQFKYYPNVPEPNEDVTFVSQSYDPEGEIAYYTWNFGDGTVVNTTESIIHHKYTN
PGYYTVTLTVFDKYNASASISKQILVAGILANFTYEINGSTVKFEDKSYVAPGKIVSWYW
NFGDGSTSTERNPIHTYNKEGAYFVTLTVKSDTNLTDSVTKIVIVSPTPKYPPVADFTYI
INGTTVEFNASKSYDKDGHIVEYIWNFGDGNITTTTSPITIHKYEKEGVYAVTLTVIDND
GLSDSRTKLINVGKSFIHSVPIPPYIEILVIISTLFCFLQIIRGLK
Download sequence
Identical sequences D3S482
gi|289192441|ref|YP_003458382.1| WP_012980555.1.35598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]