SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289192901|ref|YP_003458842.1| from Methanocaldococcus sp. FS406-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289192901|ref|YP_003458842.1|
Domain Number 1 Region: 44-176
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.75e-40
Family MJ1460-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289192901|ref|YP_003458842.1|
Sequence length 179
Comment 4-vinyl reductase 4VR [Methanocaldococcus sp. FS406-22]
Sequence
MKVELKARGIEELSKIFCEGDFIITDDSELINEAVEYLKKEFNEDKKEKRKYIPLELFKA
VVFIMMKKIKELDSEITLYDIGYEFGKHLNPKKYTDLKKFFKRNNLGILKIESRKPLILK
VENCAFCEDLNFDEPICYFDAGLIAGAFECILEKPVVVDEIKCMAKGDDACYFKVEVVK
Download sequence
Identical sequences D3S5J2
WP_012981014.1.35598 gi|289192901|ref|YP_003458842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]