SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289549942|ref|YP_003470846.1| from Staphylococcus lugdunensis HKU09-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289549942|ref|YP_003470846.1|
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 5.75e-20
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289549942|ref|YP_003470846.1|
Sequence length 157
Comment transcriptional activator [Staphylococcus lugdunensis HKU09-01]
Sequence
MQYRLEQLEEIQVVGFHRSYRSGTQAQKHIASFWEDVISAHIDEELARHSDGTLNGLLGV
CISHEDGRMDYLIGVTNQSIPHEGYSKVQLVKGDYLVVTTSGPFPDSIQRTMRHIHVNLL
PREGFRIKDANFFELYLPGDIESDDYVAEIWLPIESE
Download sequence
Identical sequences A0A133Q5M0
WP_002460315.1.101638 WP_002460315.1.101730 WP_002460315.1.17324 WP_002460315.1.17721 WP_002460315.1.23407 WP_002460315.1.25151 WP_002460315.1.31577 WP_002460315.1.33459 WP_002460315.1.56268 WP_002460315.1.5723 WP_002460315.1.64738 WP_002460315.1.6482 WP_002460315.1.69746 WP_002460315.1.75722 WP_002460315.1.76753 WP_002460315.1.80048 WP_002460315.1.86142 WP_002460315.1.87551 WP_002460315.1.96268 WP_002460315.1.99146 gi|289549942|ref|YP_003470846.1| gi|385783520|ref|YP_005759693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]