SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289550721|ref|YP_003471625.1| from Staphylococcus lugdunensis HKU09-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289550721|ref|YP_003471625.1|
Domain Number 1 Region: 130-281
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000214
Family Rob transcription factor, C-terminal domain 0.096
Further Details:      
 
Domain Number 2 Region: 5-54
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000273
Family AraC type transcriptional activator 0.013
Further Details:      
 
Weak hits

Sequence:  gi|289550721|ref|YP_003471625.1|
Domain Number - Region: 57-103
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000224
Family AraC type transcriptional activator 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289550721|ref|YP_003471625.1|
Sequence length 293
Comment AraC family transcriptional regulator [Staphylococcus lugdunensis HKU09-01]
Sequence
MDVIKQLQQAIVYIEDRITEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPSNYAQARKMT
LAAEDMIQNSSRLVDVAKKYQYANANDFANDFSRFHGLSPIQASTKKNELKIQKRVYIKL
STTEREPFPYRLEETSDIALVGHARYINTNQLSNPFNVPDFLEDLYLDGKIKDLLKYNNI
SPYELFVISCPLDNGLEIFVGVPSDRYPMHLESRRLPGRHYAKFNLHGEIDYAVNEAWHF
IETSLQLTLPYERDSLYVEIYPHEISFEQPTKIQLWLPIQQETYHVDSEDEIE
Download sequence
Identical sequences A0A2K4BRJ1
WP_012990838.1.101376 WP_012990838.1.17721 WP_012990838.1.24585 WP_012990838.1.24704 WP_012990838.1.25151 WP_012990838.1.31577 WP_012990838.1.33459 WP_012990838.1.54330 WP_012990838.1.5723 WP_012990838.1.64738 WP_012990838.1.71591 WP_012990838.1.76753 WP_012990838.1.80048 WP_012990838.1.95427 WP_012990838.1.95854 WP_012990838.1.99146 gi|289550721|ref|YP_003471625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]