SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289551790|ref|YP_003472694.1| from Staphylococcus lugdunensis HKU09-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289551790|ref|YP_003472694.1|
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 4.58e-99
Family Homocysteine S-methyltransferase 0.00000453
Further Details:      
 
Domain Number 2 Region: 317-600
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.77e-63
Family Methylenetetrahydrofolate reductase 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289551790|ref|YP_003472694.1|
Sequence length 612
Comment homocysteine-binding domain-containing 5,10-methylenetetrahydrofolate reductase [Staphylococcus lugdunensis HKU09-01]
Sequence
MSQFLNQLQNNILVADGAIGTILYSEGLDTCPEAYNLTHPDKVERIHRSYIEAGADVIQT
NTYGANFEKLKPFGLEHKVKEIHKAAVKIAKRAATKNTFILGTVGGFRGIKQDDISLSTI
QYHTENQIDTLIEEGVDALLFETYYDLDELKRIVTWTKRNYDIPVVAQLTASNTTYLVDG
TEINDALAQLVTCGADVVGLNCHHGPHHMEKSFSHIALPDNAYLSCYPNASLLDIENSEF
KYNDNAQYFGAVAEKLIEQGVRLIGGCCGTTPQHIHYIKSSVSHLSPVNHKKVIPIHKKS
NQRRTDSIKQSLTSKVKQGPTVIVELDTPKHLDTDLFFENIGKLDAAHIDAVTLADNSLA
TVRISNIAASSLIKQRYDIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSKV
GHLPGSTNVYDVNSKGLTELALRFNQGINTDGDALKKHTNFNIAGAFDPNVRKLDGAVKR
LEKKIASGMSYFITQPVYSKEKIIQVYEATKHLNIPIFIGIMPIASYNNALFLHNEVPGI
KMSESVLNQFKAVKDDKEKTKELSLRLSKDLIDTVHQYFNGLYIITPFQRVDYSLELAAY
SRSITTNKEAIL
Download sequence
Identical sequences gi|289551790|ref|YP_003472694.1| WP_012991035.1.25151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]