SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289550866|ref|YP_003471770.1| from Staphylococcus lugdunensis HKU09-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289550866|ref|YP_003471770.1|
Domain Number 1 Region: 6-224,900-989
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-19
Family ABC transporter ATPase domain-like 0.029
Further Details:      
 
Domain Number 2 Region: 718-993
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.9e-18
Family ABC transporter ATPase domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 472-569
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.000051
Family Rad50 coiled-coil Zn hook 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289550866|ref|YP_003471770.1|
Sequence length 1008
Comment exonuclease SbcC [Staphylococcus lugdunensis HKU09-01]
Sequence
MKPLTLTLSNFGPFLNETIDFKQVFENQLFLISGKTGSGKTMIFDGIVYALFGVASTKSR
TESDLRSHFAEAKEPMSVTFEFEINQRQFKIFRQGSYIKEGNKTKTPGKLTFYEFDGEVF
DLRESKIHEGNLFIQQLLGVNAEQFRQLFILPQGEFKRFLVSSSSDKQSILRTLFNSLRF
EQIQDILADEVKNEKQLIEQRYNKIAMVWEEIEDFEIEDLQALKQIESIQIQKLVDAIPI
FQKYGSEQLLATTKLKQAEKCQTEKLHKALVANNELEKQLNDLADYTQRFELLRQEQENI
DKLKHKITQLNEIRTLNTLVQQRESQIAKLNDFNNAITSKGKDIESIQEQQKQLQEQMQI
LIKSEHAINQYKEYIDKCHIIYQKIESHRKAMAENDNVKKQLSETQQKIKQYNEKQTKLK
KQKAENDIDYNKIVELTDELAHINKLIDKTKETLSNNQKFKELKNEYIEDKKQLKMIEKE
FEHVSNHINKLTAKNLDLNDKESFINELQSALSIGEICPVCGNEIQSLEKHIDFENIKLQ
KHQLDTLEKEKLSLTEQKIKLETEMSHAQDKMKEIKVDEEPLDLESLQVQYNEKELEKAS
FKEKYAMTKQIETQINEYKKDIHQMELQYKDLSHQRNQNEQLIGEFISTTQTKDIDSFIQ
QFESYKKQIEIFENSKEQLTNEIITANQQKQLESNNLINIQNQKHIAENEYQSVDKDIQT
EMRRYAIKDEKALFKILEDMHLKSDYEQQVEAYSKKYAALEHEIGRLKSLTHDKVLQDTK
QLENSYQVQSEKLDKVIEQENTLKYQLKKNDQKFDVLYENINYLTKELKSQQEIFNLAEI
LSGKNSQKLTLETYVLIYYLERIIAQANLRLATMSGQRYHLQRRKSLSHGYSGLEIDVFD
FHSNKSRHISSLSGGETFQASLALALGLSEVVQEESGGITLESMFIDEGFGTLDQETLDT
ALDTLVNLKSSGRMVGIISHVTELKQRIPLILEVTSKQFQSATQFKFN
Download sequence
Identical sequences gi|289550866|ref|YP_003471770.1| WP_012990853.1.25151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]