SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|281492408|ref|YP_003354388.1| from Lactococcus lactis subsp. lactis KF147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|281492408|ref|YP_003354388.1|
Domain Number 1 Region: 213-357
Classification Level Classification E-value
Superfamily CBS-domain pair 2.27e-30
Family CBS-domain pair 0.0041
Further Details:      
 
Domain Number 2 Region: 355-435
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.23e-19
Family CorC/HlyC domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|281492408|ref|YP_003354388.1|
Sequence length 445
Comment magnesium and cobalt efflux protein [Lactococcus lactis subsp. lactis KF147]
Sequence
MSNPDPESVSILLQILLLIFLTALNAFFSASEMAMVSLSRTKVEQKASEGDKKYINLVNI
LNQPSNFLSTIQIGITLINILAGASLAESLSSRLAPLLGGTALAKTLAQIIVLAVLTYVS
LVFGELYPKRIAQNLKEKLALRVAPPIQFLGKVMKPFVWFLASSTNFLSRLTPMKFDDLD
EGMTRDEIEYLLNTNDEALDANEREMITGVFSLDELVAREIMVPRTDAFMIDINDDSREN
ITAILSETYSRVPVYDDDKDNILGILHVKKLLRYSFDHGFDDIDLREILQEPLFVPETIF
VDDLMRQMRKTQNQMAVLLNEYGGVEGVVTLEDLLEEIVGEIDDETDIAEEEVFKIGENL
YVVQGKMTLNDFNEEFDTHLESNDVDTIAGYFLATTGKIPAKGQQIVCKVDNDEDHFSLT
SLEVSGKRVVKLRVEFDVEPEETEI
Download sequence
Identical sequences D2BLA7
gi|281492408|ref|YP_003354388.1| 684738.LLKF_1988 WP_012898374.1.1423 WP_012898374.1.69015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]