SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269124334|ref|YP_003297704.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269124334|ref|YP_003297704.1|
Domain Number 1 Region: 72-261
Classification Level Classification E-value
Superfamily Rhomboid-like 1.15e-41
Family Rhomboid-like 0.0019
Further Details:      
 
Domain Number 2 Region: 8-49
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000151
Family B-box zinc-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269124334|ref|YP_003297704.1|
Sequence length 302
Comment Rhomboid family protein [Thermomonospora curvata DSM 43183]
Sequence
MDAQAPGAPAEAPTCYRHPGRETYVRCTRCDRYICPDCMRDAAVGHQCVECVQEGSRTVR
RPRTVFGGQIPATPVVTYTLIALNVLVYLAQLSSSRIVYDFAMVGVRFDPYGEMHGVADG
EWYRLITAAFLHSQPGGGSFGVTHILFNMWALWVIGPQLEQVLGRWRFTSLYLLSALGGS
VLLYLVDPTGAAVGASGAIFGLFGAFFVIAKRLNAPAGGIVFLLVLNLVITFTVPGISWE
GHIGGLLTGGLLTAVYAYLPRVQGSDHQRRTVIHAVAVAALLALFIALVAVKTSELTGLL
SF
Download sequence
Identical sequences D1ADF6
471852.Tcur_0058 WP_012850450.1.83154 gi|269124334|ref|YP_003297704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]