SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269124801|ref|YP_003298171.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269124801|ref|YP_003298171.1|
Domain Number 1 Region: 11-281
Classification Level Classification E-value
Superfamily Aldolase 7.91e-60
Family SCOPe 0.00000192
Further Details:      
 
Domain Number 2 Region: 295-344
Classification Level Classification E-value
Superfamily post-HMGL domain-like 3.66e-33
Family SCOPe 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269124801|ref|YP_003298171.1|
Sequence length 355
Comment 4-hydroxy-2-oxovalerate aldolase [Thermomonospora curvata DSM 43183]
Sequence
MTDQDGATAAPRVRITDSTLRDGSHAMAHQFTEEQVRATVHALDAAGVEVIEVSHGDGLG
GSSFNYGFSAVDEIDLVAAAVDEAVNAKIAVLLLPGVGTVRDLKRAHDAGASVARIATHC
TEADVSCQHFAAARELGMETVGFLMLAHRIGPEELARQARIMVDAGAQCVYVVDSAGALV
LSDVQARVQALVREIGHEAQVGFHGHQNLSLGVANSVLAYQNGARQIDGALCALGAGAGN
SPTEILAATFERLNIETGVNVQAALAAAEEVVRPYLPRLPWADRAAIVQGYAGVYSSFLL
HAERAAERYGVPAHEILQRVGEAGYVGGQEDMIIDIAVQLAEERHGRPAPAGGRR
Download sequence
Identical sequences D1A3K8
WP_012850917.1.83154 4lrs_A 4lrt_A 4lrt_C 471852.Tcur_0536 gi|269124801|ref|YP_003298171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]