SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269125031|ref|YP_003298401.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269125031|ref|YP_003298401.1|
Domain Number - Region: 73-113
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0414
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269125031|ref|YP_003298401.1|
Sequence length 120
Comment hypothetical protein Tcur_0771 [Thermomonospora curvata DSM 43183]
Sequence
MATKVVLVDDIDGHEGEDVAKRDFEVAGAQFTIDLGDANYKKLTEVLEALAPYLEKATTV
KRATRARKSADAAPRLRGYSNTDVRQWAQAQGIELSERGKIPDEVYEQFIAAHPDAKPEG
Download sequence
Identical sequences D1A5K3
WP_012851147.1.83154 gi|269125031|ref|YP_003298401.1| 471852.Tcur_0771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]