SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269125142|ref|YP_003298512.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269125142|ref|YP_003298512.1|
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily CsrA-like 7.32e-18
Family CsrA-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269125142|ref|YP_003298512.1|
Sequence length 60
Comment carbon storage regulator CsrA [Thermomonospora curvata DSM 43183]
Sequence
MLVLSRKPGERIMLGDDIVVQVLQISGNSVRIGVEAPRSLRVWREEVWVELDRKAARQTS
Download sequence
Identical sequences D1A6J9
gi|269125142|ref|YP_003298512.1| 471852.Tcur_0884 WP_012851258.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]