SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269125269|ref|YP_003298639.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269125269|ref|YP_003298639.1|
Domain Number 1 Region: 651-732
Classification Level Classification E-value
Superfamily PKD domain 4.58e-22
Family PKD domain 0.0016
Further Details:      
 
Domain Number 2 Region: 57-301
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000267
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|269125269|ref|YP_003298639.1|
Domain Number - Region: 222-303,468-628
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000392
Family Tricorn protease N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269125269|ref|YP_003298639.1|
Sequence length 943
Comment PKD domain containing protein [Thermomonospora curvata DSM 43183]
Sequence
MRLRKAVSVMAGLAMATGALVGVPTVAQASPATGEPHNRIVSDDPVDYTPQIQDGSVKSI
VKIGDRIFIGGDFTQVKEPGGGKPMLTRNRLFSMNATTGEIDAGFNPNVGNGEVSVLLPA
SDGQSLYVGGTFTSVGGASTSRLVRINATTGQVISSFSVQTNGRVRDLRLANGRLYVAGD
FTHVNGVSRPALAAVNPNTGALLNFLDLNISGTHRGLGVTLVYKMDITPDGSKLVIIGNF
NSVAGQTRNQVAMIDLSGEQATLAPWSTTRYAELCSSSFHTYMRDVDFSPDGSFFVITTT
GAYSGGPPKLCDTHARWETAGGADQQPTWVNWTGGDTSYAVEVTDAAVYVGGHFRWANNP
FGSDKAGQGAVSREGIAALDPANGLPFSWNPGRTRGVGVFDLLATSEGLWMGSDTDEAGG
EWHPKLAMFPLAGGTKVKPNHTGELPGNVYYAGGLGLAAQNFLRHRSFDGSTAGSTVNHS
TGGFDWRTMRGAFMINGELFYGHSNGKFYRRSFDGETLGTTVTEINTADQLTNMSTWHNQ
VPNITGMFFANGRIYYTRGQSALYYRYFTPESNVVGAQELTAVGNMSGVNWSSVGGMFVH
GDKLYFVNNSSSGRLYRMNFVNGVPSGTPQLVDSNDWRGRAVFLYSGVPNELPEASFTSQ
CDQLECSFDASASEDPDGTIASYSWDFGDGKTGTGKTVEHTYDEPGTYTVKLTVTDNRGG
QGTVTEQVSVTQNATAIGYRGGAGFNANTREATVTVPSSVQPGDGMVLIMTANSTSVTIT
PPAGWTQIGTQTAGSAVSTVWKRVATAGDAGSTVSVGVSDYAKVDLRLLAYEGTDTGNPV
AAISGRVDASTVTEHATPTVTVSSAGAWAISYWADKSSSTTEWTAPSGPTIRGTGVGSGG
GRIMTLVGDTDGPVPTGSYGGLVATTDAASRGLMWTIILARQS
Download sequence
Identical sequences D1A7L2
471852.Tcur_1015 gi|269125269|ref|YP_003298639.1| WP_012851385.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]