SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269125659|ref|YP_003299029.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269125659|ref|YP_003299029.1|
Domain Number - Region: 108-174
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0733
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269125659|ref|YP_003299029.1|
Sequence length 182
Comment PASTA domain containing protein [Thermomonospora curvata DSM 43183]
Sequence
MHAQPPSSTPRPPLGQPGYPQLGVPPKRSATITVRRGVAVFALGLTAFVSCGIGGAVTAG
DTQQAGSASGASAEPKPRVTVTVTKTVTAAPQKDGAGSARPAAGDEDDRVELPDVVGKNG
AIARDILERAGFKNIDYSSADPNGASVVLLPVNWRVVKQEPAAGKKVDPTALVVLTVVKA
SS
Download sequence
Identical sequences D1AA55
471852.Tcur_1411 WP_012851775.1.83154 gi|269125659|ref|YP_003299029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]