SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269127270|ref|YP_003300640.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269127270|ref|YP_003300640.1|
Domain Number 1 Region: 18-298
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.51e-61
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269127270|ref|YP_003300640.1|
Sequence length 553
Comment cytochrome b/b6 domain-containing protein [Thermomonospora curvata DSM 43183]
Sequence
MSTPTPGAAPKAVAGPLNFLDDRLGSTTFFKRNMKKVFPDHWSFMLGEIALYSFVILLLS
GTFLTLWFQPSMHEVVYEGSYTKLQGVPMSEAYASALHISFDVRGGLLMRQIHHWAAILF
MVAIMAHMLRVFFTGAYRKPRELNWLIGLGLFTLGMVEGMFGYSLPDDLLSGTGLRITQG
VAEAVPLVGTYIYMFLFGGEFPHGDRGELIPRLYTMHVLLIPGIILALITAHMMIMWHQK
HTQMPGPGRTNDNVVGYPFYPVFMAKTGAYFLFTFGVIALLATFAQINPIWNYGPYDPGA
ISSASQPDFYMGLLEGSLRLMPGWETTAFGHTISWNVLIPGVVPIGLIFTGAALWPFIER
WITGDHRHHHLVERPRNAPIRTGVGMAGVTFYGLLWLAGANDVIAERFHVSLFATTWFFR
VAIFVGPVLAFIITKRICLGLQRKDAATMHHGVESGIIVMSPEGGFSEKHEPPTEEERAV
ILSKENKTISLPPAEKDGIPAPGAKGPLGHLRARLHRSWALDDIPVEDHGDHHEVEGAKS
EGVEGSGHKELTR
Download sequence
Identical sequences D1A8W4
gi|269127270|ref|YP_003300640.1| 471852.Tcur_3060 WP_012853386.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]