SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269128110|ref|YP_003301480.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269128110|ref|YP_003301480.1|
Domain Number 1 Region: 36-87,238-479
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.1e-62
Family Bacterial dinuclear zinc exopeptidases 0.00000479
Further Details:      
 
Domain Number 2 Region: 124-219
Classification Level Classification E-value
Superfamily PA domain 5.23e-17
Family PA domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269128110|ref|YP_003301480.1|
Sequence length 512
Comment Aminopeptidase Y [Thermomonospora curvata DSM 43183]
Sequence
MRKRHWGIPLALAGLLSGVVTAAPAEAGVQGPDLTKLVKIKDIRKHLVELERVAERNGGN
RASGQPGFDASVDYVVKVLKKAGYKPQVQNFDFEYYEQEAPTVFEQVSPAPATYTEALDG
DFLTHYYSGEGDVTARAVPVDTDDPDGVGSGCESDDFEGFPAGSIALIVRGGCTFADKAA
NAEAAGAVAAIIYQNPATADQGPVNGTLGGRVVDIPVLGPTYELGSSLVAQAKAGELILH
IKTDVFHEKRSSKNVIADTKLGDPNKTVVVGAHLDSVAEGPGINDNGSGSATVLAIAEQI
GKLGKKGLKNRVRFAWWGAEESGLIGSDAYVASLSDEELSKIALNLNFDMLGSPNFARFV
YDGDNSLGTPTDPPPGSAEIEKAFTDYFKKRKLATEPTAFDGRSDYYAFINVGIPAGGLF
SGAEVTKTPEQVKLYGGTAGEAFDKCYHQACDDLTNINWTGLDQLADGAAHVVQRYAHSV
EDVLAARTATVTLKSTSSSAGGPEWRGGHLIR
Download sequence
Identical sequences D1AE16
471852.Tcur_3913 gi|269128110|ref|YP_003301480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]