SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269128631|ref|YP_003302001.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269128631|ref|YP_003302001.1|
Domain Number 1 Region: 58-197
Classification Level Classification E-value
Superfamily Prim-pol domain 0.0000719
Family Bifunctional DNA primase/polymerase N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269128631|ref|YP_003302001.1|
Sequence length 219
Comment Bifunctional DNA primase/polymerase [Thermomonospora curvata DSM 43183]
Sequence
MLTVSAARRQRARGRLRAAAKEYAALGWPCVPGARPLFDGDRACSCDRVGCPAPGAHPVS
AAWAIQATTDLETIKRWWDDDRQPNIILPTGRVFDVFDVPAAAGRMALERIGRRYSGPGP
TSPVGPVAALGSERHLFFVATRGAPEDEDEWWSCHLDCSPETIDDSPGLRWHCRESYVVA
PPSILPGGEVTWVRPPDGALLPDPVRVLEILSDCCEAVC
Download sequence
Identical sequences D1A489
471852.Tcur_4436 WP_012854746.1.83154 gi|269128631|ref|YP_003302001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]