SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269128993|ref|YP_003302363.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269128993|ref|YP_003302363.1|
Domain Number 1 Region: 80-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000706
Family NfeD domain-like 0.01
Further Details:      
 
Weak hits

Sequence:  gi|269128993|ref|YP_003302363.1|
Domain Number - Region: 8-57
Classification Level Classification E-value
Superfamily Clc chloride channel 0.017
Family Clc chloride channel 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269128993|ref|YP_003302363.1|
Sequence length 143
Comment hypothetical protein Tcur_4808 [Thermomonospora curvata DSM 43183]
Sequence
MEAWIVWLIVAAALGVAELFTLTLALGLLAVAAAAAGLAGLAGLPLLAQVLVFVVASAAG
LGLVRPVARRHIRQPPPLRTGAAALVGKEALTLTEVSKRGGLVRIGGEEWSARPYDPDLV
IPAGADVDVLGIEGAIALVYPRE
Download sequence
Identical sequences D1A7C0
471852.Tcur_4808 gi|269128993|ref|YP_003302363.1| WP_012855107.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]