SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269129104|ref|YP_003302474.1| from Thermomonospora curvata DSM 43183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269129104|ref|YP_003302474.1|
Domain Number 1 Region: 227-249,281-657
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.05e-80
Family beta-Lactamase/D-ala carboxypeptidase 0.0018
Further Details:      
 
Domain Number 2 Region: 48-267
Classification Level Classification E-value
Superfamily Lysozyme-like 3.37e-69
Family PBP transglycosylase domain-like 0.0000171
Further Details:      
 
Weak hits

Sequence:  gi|269129104|ref|YP_003302474.1|
Domain Number - Region: 666-727
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269129104|ref|YP_003302474.1|
Sequence length 747
Comment peptidoglycan glycosyltransferase [Thermomonospora curvata DSM 43183]
Sequence
MRLLGAGVVAGVLVAFIALPGVGGAGLTARDAANGFQNMDAELNTAPPPEKTVVYDARGN
QVAVFFDKYRESVRLDQIAPIMRKAVIAIEDSRFYEHGALDLKGTLRALVNNASSGGETR
QGGSTLTQQYVKNLLVENAKTDEEYRAATAPTLQRKINELRYALHLEETMTKDEILEGYL
NIAYFGGGAYGVQAAAKRWFSKPASKLALPEAALLAGITQNPSAYDPKLHPKAARQRRDT
VLYRMAELNMITREEAEKAAAQPIELNEDKPVGGCETSKAPFFCEYVRYEMYQILSDGKY
WKLSKERQAEVESRLKRGGYVIRTTLDMKAQNALDRALRSRVSPTSNKVAAEAMVQPGTG
HIKAMGASKQFGAGKGKTTLNLAADAQHGGGVGVSAGSTFKTFTLAAALEEGIPVRTSIH
SPSRMVIGGFTDCEGNVHHGWNVGNADPAENGPYNLKTGTWLSVNTFYAQLQKRVGLCDA
VKMAERFGMKQGNGQPLKQVMSQVLGVNEVDMVHLAAAYAGFAARGKYCEPVAVTEVVGP
DGKKLKLPKKECRQAVSQDVADKVNEILQGVLTKGTAKGHGIGRPAAGKTGTCEAFTCAA
FAGHTPNLAAAVAYWDYRGPWKYKVYGVYGATIPAPIWAASMRGALAGEPAPSFNTPARD
FGDTEEVPDVRGRRVREAIAILRRAGLTWEIVPRRVPSDRPRGTVATTSPGPGDEIEPGG
KVMLYISSGRDRGRPERNEGFRWPWED
Download sequence
Identical sequences D1A8C2
gi|269129104|ref|YP_003302474.1| WP_012855218.1.83154 471852.Tcur_4921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]