SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289433574|ref|YP_003463446.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289433574|ref|YP_003463446.1|
Domain Number 1 Region: 456-646
Classification Level Classification E-value
Superfamily PRTase-like 6.95e-60
Family Phosphoribosyltransferases (PRTases) 0.00000349
Further Details:      
 
Domain Number 2 Region: 10-240
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.67e-59
Family PP-loop ATPase 0.00012
Further Details:      
 
Domain Number 3 Region: 364-445
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 4 Region: 217-325
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000314
Family MesJ substrate recognition domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289433574|ref|YP_003463446.1|
Sequence length 648
Comment hypothetical protein lse_0205 [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MDDTTKRVHNYIEKHDLIWSDDKLLVAVSGGPDSLALLHFLQMSNLVPKKAISVAHLNHG
LRENAIKEQLIVRNYCEKHKIPFFIEEVNVKKRAETMQKGIEETARLARYEFFEKIMAEE
NINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKRSMRGGQAIRPFLSITKAEIIDY
ANRHELTYEIDESNSSPKYTRNRYRKEILPFLTKENPGVYAHFERFSEETSEDFRYLEDL
ASDLLKKNLIKNGEQATLLLTSFKNEANPLQRRAIHLLLRYLYNKDAGLITANHIYQIIQ
MIQSDNPSSSLNLPKKLTAKRSYNELHFQFGERDVPAEFYHQLELNDRIELESKASIRLK
LKSSVVQTNGLNGMLLDAADITLPLIVRNRVNGDRMTMKGQAGSKKLKDIFIDAKIPRQE
RDNLPVITDYTGKILWIPGVKKSAYDREFSRNKKQYIIRYTRNLGGNESMHNDIQKVLIS
EDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFMTDLLKRVDTYLEMDFMDVSSYGN
GTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTLLDKP
AGRNVAIEADYVGFVVPNEFVVGYGLDYAERYRNLPYIGVLKPEIYSE
Download sequence
Identical sequences gi|289433574|ref|YP_003463446.1| WP_012984733.1.31702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]