SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434324|ref|YP_003464196.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434324|ref|YP_003464196.1|
Domain Number 1 Region: 3-211
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-56
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 154-303
Classification Level Classification E-value
Superfamily Translation proteins 1.56e-31
Family Elongation factors 0.0029
Further Details:      
 
Domain Number 3 Region: 402-517
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.8e-30
Family EF-G/eEF-2 domains III and V 0.002
Further Details:      
 
Domain Number 4 Region: 306-391
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000194
Family EF-G/eEF-2 domains III and V 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289434324|ref|YP_003464196.1|
Sequence length 612
Comment GTP-binding protein TypA [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MNLRNDIRNVAIIAHVDHGKTTLVDQLLRQSGTFRDNETVAERAMDNNDLERERGITILA
KNTAIKYEDTRVNIMDTPGHADFGGEVERIMKMVDGVLLVVDAYEGTMPQTRFVLKKALE
QNLTPIVVVNKIDRDFARPEEVVDEVLELFIELGANDDQLEFPVVYASAINGTSSYDSDP
AEQKETMKPLLDTIIEHIPAPVDNSDEPLQFQVSLLDYNDYVGRIGIGRVFRGTMHVGQT
VALIKLDGTVKQFRVSKMFGFFGLKRDEIKEAKAGDLVALAGMEDIFVGETVTPFDHQEA
LPLLRIDEPTLQMTFVTNNSPFAGREGKHVTSRKIEERLLAELQTDVSLRVEPTASPDAW
VVSGRGELHLSILIETMRREGYELQVSKPEVIIREIDGVKCEPVEDVQIDTPEEFMGSVI
ESISQRKGEMKNMINDGNGQVRLQFIVPARGLIGYTTDFLSMTRGYGIINHTFDSYQPIQ
KGRVGGRSRGVLVSMETGKSTTYGTMQVEDRGTIFIEPGTDIYEGMIVGENNRDGDIAVN
IVKAKQMTNIRSANKDQTNVIKKPRHLSLEESLEFLNEDEYCEVTPQSIRLRKKILNKNE
REKAAKRSKTAE
Download sequence
Identical sequences A0A0F5Z4U8 E3ZP47
gi|289434324|ref|YP_003464196.1| WP_003746802.1.27649 WP_003746802.1.31702 WP_003746802.1.71328 WP_003746802.1.96308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]