SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434471|ref|YP_003464343.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434471|ref|YP_003464343.1|
Domain Number 1 Region: 208-405
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-60
Family B3/B4 domain of PheRS, PheT 0.0000139
Further Details:      
 
Domain Number 2 Region: 475-695
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.93e-52
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000767
Further Details:      
 
Domain Number 3 Region: 36-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.32e-45
Family Myf domain 0.0076
Further Details:      
 
Domain Number 4 Region: 704-802
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-31
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 412-483
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.84e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289434471|ref|YP_003464343.1|
Sequence length 802
Comment phenylalanyl-tRNA synthetase subunit beta [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MLVSYNWVKEFFEEFPLSAEELGEAITRTGIEIEGVEELSASLKNVVVGEVLTCERHPDA
EKLNKCLVQTDEKEPVQIICGAPNVAAGQKVIVAKVGARLPGGLKIKRAKLRGEVSEGMI
CSLSELGFESKVVPKAYADGIYVLPEHVEVGVSAISLLGLDDAILDMAITPNRADALSMN
GVAHEVGAIIHQKPAQPTQPDVSEKGTADTFLTVEVENPTETPYYAIKMVENITIKESPL
WLQTKLMKAGIRPHNNVVDVTNYINLLYGQPLHSFDYDKIGSKKIVVRSAKENEEITTLD
GEKRKLQAGHTVITNGKEPIAIAGVMGGESSEVTENTTVVALEGAIFSSSSIGKASRELY
LRTEASIRYDKGSDAWKVEKALAHGGALIAELSGGTLVGGVVEVDNRAKAINKIETSLTR
INRILGTEITLAEIETIFDRLGFVLEVNDDKLIIEVPSRRWDITIEADILEEVARIYGYD
EIPVTLPATSTTGGLSLNQKARRVMRNYLEGAGLNQALTYSLTSKKDATRLALSNEKTVA
LSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVALYEMGTVFYATEGDNLPIEQEHLA
GLITGNWHEADWQKTPKPVDFFVLKGIVEGLVKKLGIKADLVWKQTEKEELHPGRTASIY
IEGKEIGYLGGLHPAVEASADLKETYVFEINVEEVLAASKEKVVYHPIPRYPEMTRDLAL
LVDKNTDHATILEVIKSHGGNLLVDIELFDIFEGESLGENKKSLAYTLTFLDSERTLVEE
DVQKATNKVVEVLQEKLNAIIR
Download sequence
Identical sequences gi|289434471|ref|YP_003464343.1| WP_012985437.1.31702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]